PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8KG105500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 232aa    MW: 25445.6 Da    PI: 8.2896
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8KG105500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.68.8e-18106160256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          r++ +++keq   Le+ F+++++++ ++  +LA++l+L  +qV +WFqNrRa+ k
  Pavir.8KG105500.1.p 106 RTKKRLSKEQYGFLEDSFKEHSTLTPRQNSDLASRLNLGPQQVAIWFQNRRARTK 160
                          677889***********************************************98 PP

2HD-ZIP_I/II107.78.6e-35107196291
          HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                           k+rlskeq  +LE+sF+e+++L+p++ ++la++L+l p+qva+WFqnrRARtk +q+ +++e+Lkr + al++en+rL+ ev++Lr+ l
  Pavir.8KG105500.1.p 107 TKKRLSKEQYGFLEDSFKEHSTLTPRQNSDLASRLNLGPQQVAIWFQNRRARTKVQQTKEECEKLKRGCAALTQENRRLQGEVAQLRALL 196
                          69************************************************************************************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.71102162IPR001356Homeobox domain
SuperFamilySSF466895.01E-17104169IPR009057Homeodomain-like
SMARTSM003892.9E-13104166IPR001356Homeobox domain
PfamPF000464.7E-15106160IPR001356Homeobox domain
CDDcd000861.02E-12106163No hitNo description
Gene3DG3DSA:1.10.10.602.0E-16106158IPR009057Homeodomain-like
PROSITE patternPS000270137160IPR017970Homeobox, conserved site
Gene3DG3DSA:1.20.5.1705.4E-4159195No hitNo description
SMARTSM003401.1E-10162205IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MELELNLGVS PALAKGTARH MLTCTRAGDG EGHDELVLEL GVRTAKGDEL DNLETSMQPE  60
DVREEDLYQG CPQPTASAET GSVSSSLQVE VPMRQAAKDK GGFGGRTKKR LSKEQYGFLE  120
DSFKEHSTLT PRQNSDLASR LNLGPQQVAI WFQNRRARTK VQQTKEECEK LKRGCAALTQ  180
ENRRLQGEVA QLRALLTNPA SFAATNQLRS FGHCAAGPAR VDFSCTPRRR C*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952725.11e-61PREDICTED: homeobox-leucine zipper protein HOX7-like
SwissprotA2X6743e-47HOX7_ORYSI; Homeobox-leucine zipper protein HOX7
TrEMBLK3YZM61e-50K3YZM6_SETIT; Uncharacterized protein
STRINGSi019736m4e-50(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP128943035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-36homeobox from Arabidopsis thaliana